PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.17G078400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family WOX
Protein Properties Length: 346aa    MW: 39670.3 Da    PI: 7.6291
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.17G078400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.22.4e-2286145357
                          --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
             Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                          +R+++t+eql +Lee++++ +r+p+ae+++++A++l    +++ ++V++WFqN++a+e++
  Manes.17G078400.1.p  86 SRWNPTPEQLLALEEMYRRgTRTPTAEQIQQIAAQLrrfgKIEGKNVFYWFQNHKARERQ 145
                          7*****************99**************************************97 PP

2Wus_type_Homeobox113.31.2e-3685147365
    Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                          ++RW+PtpeQ+  Lee+y++G+rtP++e+iq+i+a+L+++Gkie+kNVfyWFQN+kaRerqk+
  Manes.17G078400.1.p  85 SSRWNPTPEQLLALEEMYRRGTRTPTAEQIQQIAAQLRRFGKIEGKNVFYWFQNHKARERQKR 147
                          79***********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.83981146IPR001356Homeobox domain
SMARTSM003894.2E-883150IPR001356Homeobox domain
SuperFamilySSF466899.64E-1485150IPR009057Homeodomain-like
PfamPF000466.7E-2086145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.608.5E-1086145IPR009057Homeodomain-like
CDDcd000869.75E-787147No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MNTGDENDLN MNDSVHFAEF LPTLSPKPKI KNTHITKTQP YSTCTHSTGS TLLGLDDQLL  60
GNHANASDQT RREMFMNEQP LMGMSSRWNP TPEQLLALEE MYRRGTRTPT AEQIQQIAAQ  120
LRRFGKIEGK NVFYWFQNHK ARERQKRRRE VETGCKVRKH DTTEALNMKE SAAGLRSTVY  180
EAEQKKTLVS SSSCSEHLQG SVSMLRAVTT ESTTHGWPQF EERELHQHKS YSVEKNATWQ  240
AMDLSPSSCH IQLINNFTTR SSSSRFLNSH QKQNSWLMKP RRKSEKETNP DDDVEEVETL  300
ELFPLCSSDD CNKVQGRKND TEVPITDINT KLNPNQFFEF LPLKN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526032.11e-116PREDICTED: WUSCHEL-related homeobox 1
TrEMBLB9SJ631e-116B9SJ63_RICCO; Protein WUSCHEL, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28923471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.15e-41WUSCHEL related homeobox 1